Protein Info for SM_b20885 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 270 to 286 (17 residues), see Phobius details PF00892: EamA" amino acids 9 to 136 (128 residues), 47.2 bits, see alignment E=1.3e-16 amino acids 161 to 287 (127 residues), 51.9 bits, see alignment E=4.6e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4539)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UF2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SM_b20885 hypothetical protein (Sinorhizobium meliloti 1021)
MLARLAPAIFVLLWSTGWVVAKYAAIFADPLIFLALRYSFAILLFIGFCLLSGARWPRSA
TAIGHAVVSGIFLHGLYLGAVWWAIGQGVPAAISGIIAGLQPLMTAAVAPWLIGEKLAGQ
QKLGLILGFCGIALAVAPKMLTIDATATPIHLLPLAVNVLGMAAVTYGTLYQKRYLQTGD
IRSIAALQYVGALLVTIPLALMLEDLRVTWNIELVAALAWSVLGLSMGAIALLLYLIRRG
QVSRAASLIYLVPPLAAGEAALFFGEALTWPMIIGTVIAVTGVYLTNRKAAGGTAASEPA
KEMPAV