Protein Info for SM_b20880 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF00270: DEAD" amino acids 26 to 195 (170 residues), 165.7 bits, see alignment E=1.2e-52 PF04851: ResIII" amino acids 27 to 191 (165 residues), 30.7 bits, see alignment E=4.2e-11 PF00271: Helicase_C" amino acids 233 to 341 (109 residues), 110 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 100% identity to sme:SM_b20880)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UF7 at UniProt or InterPro

Protein Sequence (503 amino acids)

>SM_b20880 ATP-dependent RNA helicase (Sinorhizobium meliloti 1021)
MSTFKELGLSEHIVATLSANGFEKPTPIQAQAIPLVLKDHDLIGLAQTGTGKTAAFGLPM
IEKLVADGRRPDPRNIRALVLAPTRELVNQIAANLKLFVKKSPLKIGLVVGGVSINKQTE
QLARGVDILVATPGRLLDLVSRKAVTLTQARYLVLDEADQMLDLGFIHDLRKISKLVPKN
RQTLLFSATMPKLIAELAGEYLTDPVKVEVSPPGKAADKVEQYVHFVPGKDLKTTILKQT
LTANPDGLSLIFSRTKHGAEKLMKHLDHVGFKAASIHGNKSQGQRERALKAFRDGEIRVL
VATDVAARGIDIPGVTHVYNYDLPEVPDAYVHRIGRTARNGRDGIAIAFCAPDEIRLLRD
IEKLMGIQIAVASGEAPADQARPSKGRGGRGNGQPRGNGQPRGNGAGQRQGGPRRDRPQR
QAAAGGFAGDELLRDERSHERRDQRAAGHGPADGRPEGHRNHKAQKHHGRPGPQQARRGS
EQSGERNGGGNRPQRADGRGHQR