Protein Info for SM_b20857 in Sinorhizobium meliloti 1021

Annotation: glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF06560: GPI" amino acids 27 to 194 (168 residues), 252.1 bits, see alignment E=1.1e-79

Best Hits

Swiss-Prot: 100% identical to G6PI2_RHIME: Putative glucose-6-phosphate isomerase 2 (pgiA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06859, glucose-6-phosphate isomerase, archaeal [EC: 5.3.1.9] (inferred from 100% identity to sme:SM_b20857)

MetaCyc: 40% identical to phosphoglucose isomerase subunit (Pyrococcus furiosus)
Glucose-6-phosphate isomerase. [EC: 5.3.1.9]

Predicted SEED Role

"Glucose-6-phosphate isomerase, archaeal (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.9

Use Curated BLAST to search for 5.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UI1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>SM_b20857 glucose-6-phosphate isomerase (Sinorhizobium meliloti 1021)
MLILFEPGVCQVDVATGRLKGATNRYVKTFRDLAGLYRDESAYQALIATRGDDVAYEVTD
YKPSANGGDIIIGVTRMEPGKIGDEYFMTRGHIHARPNRPEMYYGEAGVGVMLLESPHGE
IRTIEMRARTMCYVPPFWIHRSVNVGLEPLVMTFSYPADAGQDYDVIAKAGGMRTVLSMT
GTVDGPQSITPVIQGDTHRL