Protein Info for SM_b20850 in Sinorhizobium meliloti 1021

Updated annotation (from data): L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3)
Rationale: Specifically important for utilizing L-Rhamnose monohydrate. Automated validation from mutant phenotype: the predicted function (1.1.2.3) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF01070: FMN_dh" amino acids 14 to 377 (364 residues), 465.5 bits, see alignment E=1.7e-143 PF03060: NMO" amino acids 258 to 335 (78 residues), 29.6 bits, see alignment E=7.5e-11 PF01645: Glu_synthase" amino acids 296 to 338 (43 residues), 27 bits, see alignment 3.9e-10

Best Hits

Swiss-Prot: 47% identical to LLDD_CAUVC: L-lactate dehydrogenase (lldD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to smk:Sinme_4575)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UI7 at UniProt or InterPro

Protein Sequence (378 amino acids)

>SM_b20850 L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (Sinorhizobium meliloti 1021)
MTQILEIRDLKALARRRVPKLFFDYADSGAWTEGTYRANEEDFAGIKLRQRVLVDMSDRS
LETTMIGQKVSMPVALAPTGLTGMQHADGEMLAAQAAEAFGVPFTLSTMSICSIEDVASV
TTKPFWFQLYVMREREFVLDLIDRAKAAKCSALVMTLDLQILGQRHKDLRNGLSAPPRLT
PKHLWMMATRPGWCMKMLGTNRRTFRNIVGHAKSVADLSSLQAWTNEQFDPQLSWKDVEW
IKERWGGPLILKGILDPEDAKMAAKTGADAIIVSNHGGRQLDGAHSSISMLPRIVEAVGD
QIEVHLDGGIRSGQDVLKAIALGAKGTYIGRPFLYGLGALGKEGVTLALDIIRKEMDTTM
ALCGKRRITEVGRDIIAE