Protein Info for SM_b20843 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 111 to 114 (4 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 240 to 242 (3 residues), see Phobius details amino acids 248 to 263 (16 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 480 to 498 (19 residues), see Phobius details PF03062: MBOAT" amino acids 139 to 364 (226 residues), 56 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20843)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VW1 at UniProt or InterPro

Protein Sequence (508 amino acids)

>SM_b20843 hypothetical protein (Sinorhizobium meliloti 1021)
MTLIAFYLALLTRGRNEALLVIFTASIIFYAPYGISSVFLLLVALLVNFGVSNALLAMDD
SNPYRRVLYGCGQGYNIASLCYFKYKIVTVLLGDNNDFLTDIAGVAIPAGISFYTFHQAA
FLADAYVREKSVVEFFAGTRSLRAGFWAFCRYGAFVSFFPQLIIGPITYLHEFHPQVKSR
KFISFDPLNIAVGLAFISIGMFKKVVIADNIAPTVDLVFGAAGAGAVMDPAHAWIGALSY
MAQLYFDFSGYSDMALGLARMFGLRYPLNFYSPFKANGILDYYRRWNMTLTRVIARFLFT
PLSIAGTRYCAVHRLSPLPTQVLSLWLPMLINFQVLSLWHGAAWTFVAFGLMQGVWSAAE
AQIRGSKKYKRMCKSTSPFFRLLVERAIFFMLICLSLAMFRSESVGAAFHLYAQMFGASL
DAPSAFEMREPVLMLFCAFSIIYLMPNAVELMRRYRPAMMTYENESYGFAFLRSIWRPSW
GWAAFAAILTISSLHYVSRQPPFLYQGF