Protein Info for SM_b20822 in Sinorhizobium meliloti 1021

Annotation: cell surface polysaccharide export ABC-2 transporter permease, close relative to wzm1Y20833

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 121 to 148 (28 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details PF01061: ABC2_membrane" amino acids 28 to 234 (207 residues), 33.8 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to sme:SM_b20822)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VY5 at UniProt or InterPro

Protein Sequence (274 amino acids)

>SM_b20822 cell surface polysaccharide export ABC-2 transporter permease, close relative to wzm1Y20833 (Sinorhizobium meliloti 1021)
MRGSNHSSMAIHLRSDVNLIQQHLRVTAALIVREMSTRFGSKPGGYLWAIFDPVAHVALM
TLIFQAIARMPALGLSFPLFFASGYLPFAFYQRMSSFMAGTVKANKALFSYPIVTPFDAI
VSRFILQLMTDTLVTILILMMIIELGGVTQPMNLGGMIEAAGAAALLGLGIGTINIVMFA
RFSLYEQIFGIINRPLFMISGVFFLPESLPHPFRDFLLYNPLVHVIMWFRASIYPEYRAD
LLDKGYVIEFALVCFVAGLLLLTTSMREIREDRL