Protein Info for SM_b20810 in Sinorhizobium meliloti 1021

Annotation: membrane-located cell surface saccharide acetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 336 (320 residues), 114.3 bits, see alignment E=6.5e-37 PF19040: SGNH" amino acids 420 to 663 (244 residues), 172.2 bits, see alignment E=1.6e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5201)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VZ7 at UniProt or InterPro

Protein Sequence (677 amino acids)

>SM_b20810 membrane-located cell surface saccharide acetylase (Sinorhizobium meliloti 1021)
MGTRLAVIHRDFEYRPDLDGLRAVAILPVLLFHAGFSSFSGGFVGVDVFFVLSGFFMARI
ILTDLERGSFSFWSFYLRRMRRIFPALFSMIAVSAVASWFLLMPQEFRYFGDSVQAAALF
TSNILFRSESGYFDLSSEMKPLLHTWSLSVEEQFYLIFPVAVFLAFKFAHRHIRAIVLAV
ALLSFGASTWGIVHSPEKAFYLLHFRVWELLIGVLVAIAPASTYGARGSQALAALGLLAV
LLAVFVYSPDTPFPGIYAAVPCLGTALVIHAHCRGGAIGRLLGNPVSVFIGRISYSLYLW
HWPIIVFLRYGLGHELTTGWALTAVAMSFALAYISWRFVEQPARYGVLASSRVAIIGVSS
AAISSAVAFGFIVNDLEGIPQRLPEKARTLYQATYDESPFSSKRCFTDSNGEGLTPVQIR
RGEICRVGVETAGEPRFLVWGDSHAAAIAPAIDLAARQMGISGMFVGRGSCPPLPNTDFG
PPGAVKRCIDHNSAVMSLIEKRKFAFVFMVGYWPKYVHRDELPGQGIFFDPRVVPSRTDW
STPVRKGLDATLTKLARQGSKAVLVMDVPEMGYDVPEALARAAASGRSLDIAPSVEYTNK
RQALARRVLADAARSSGALVVDPMSAICDASKCHAMREGTVLYKDGDHLSAKGAESLSAL
FRPVLSIMRESVQAASR