Protein Info for SM_b20809 in Sinorhizobium meliloti 1021

Annotation: arabinose-5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF01380: SIS" amino acids 51 to 180 (130 residues), 99.4 bits, see alignment E=1.5e-32 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 53 to 319 (267 residues), 275.1 bits, see alignment E=3.3e-86 PF00571: CBS" amino acids 219 to 264 (46 residues), 27.3 bits, see alignment 3.7e-10 amino acids 273 to 326 (54 residues), 31.5 bits, see alignment 1.8e-11

Best Hits

Swiss-Prot: 47% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to sme:SM_b20809)

MetaCyc: 44% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VZ8 at UniProt or InterPro

Protein Sequence (329 amino acids)

>SM_b20809 arabinose-5-phosphate isomerase (Sinorhizobium meliloti 1021)
MNVVVSDPILASISRTIATAADGINALAGCLEDNAALRRSFVDAIELVASKRGRVVVAGV
GKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGMITAEDLLILLSWSGETVELGNVLT
YAKRFNVPVISVTSNADSTIARNSTIPVVLPKVPEACPHGLAPTTSAMLQLAVGDALAIA
LLERRGFSAEDFKTFHPGGKLGSQLLLAHELAHSGEAVPLLPIGSPMSEAVIQMSSKGFG
VVGVVGGDGELVGVITDGDLRRHMSQSLLLLTVETVMSHMPRVITPGMLASAAMEMMQSQ
KITVLFLVDDVGRPSGILHVHDLLRAGVA