Protein Info for SM_b20807 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 59 to 77 (19 residues), see Phobius details amino acids 112 to 140 (29 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 205 to 234 (30 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details PF13231: PMT_2" amino acids 103 to 265 (163 residues), 45.6 bits, see alignment E=4.5e-16

Best Hits

Swiss-Prot: 38% identical to RGTB_RHIL3: Lipopolysaccharide core galacturonosyltransferase RgtB (rgtB) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20807)

Predicted SEED Role

"FIG01075354: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W00 at UniProt or InterPro

Protein Sequence (545 amino acids)

>SM_b20807 hypothetical protein (Sinorhizobium meliloti 1021)
MKPRAAERCGWLSVVHRRASGNFRELRLVALSLARDIATNAGENDGGRMRSLLVRRPDLL
YVLIAGYCLLSIILKVLRPDSLEIDESEQALLSQYLLLGYGAQPPFYNWLQYGVVALFGI
SVASLAIVKNGLLFLFLLFYGLTARLLSSSRLAPAVAVLGVLTLPPVFLLSQRDLSHTVA
ALFAVSLFLYGFFRALKSPPKVSHYLLVGVAVGLGAISKYNFVILPVAALLAILPEAKLR
KYLFDWRVLASVAVCAMIVAPHAYWIVNNLGHATGVTVAEMKEGADSARLPHAIQGLVSL
AVSALKGVALTLAVFGLLFYADVGKILRAESLGTRVIGRMIVACFLIIAFIVVAMDATHI
RAKWLALFTALLPLYLTLKIDAADLDPARRLPALFSISGILSVGVIVMLWARVFVGPMIG
DYSFAHTPYNGFASTVRADPGPPPVAIVVDDRIVAGNLRIQFPDTPIILTGFSQEAEKHL
PPGRILAAWSAEGKGREEVPPRITGLLQLMPVRIADAKPTIVSVPYNAGRPGDTYTFAYI
WADFH