Protein Info for SM_b20787 in Sinorhizobium meliloti 1021

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 221 to 251 (31 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 274 (266 residues), 97.1 bits, see alignment E=5.1e-32

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to smk:Sinme_4263)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TN1 at UniProt or InterPro

Protein Sequence (287 amino acids)

>SM_b20787 branched-chain amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MQTIFSIAVDALAYGTVLFVISIGLSVTLGLMRVVNLAHGAFAMIGGYIASYAARDLGLG
YGAAVLIAVFGTIVIAIPIERLLYRRIYGQPELTQVLMTIGITFCIIGIANYVFGPTLKT
IPLPPSLEGSADLGFRSIAVHRIFAIVCGLAVAGALWFAIEKTAFGVKLRAAVDNAAMAA
ALGVRTEVVYAVSFAVAVGLAAFGGVVGAELLPVEPYYALRYMVTFLVVVSVGGAGSIPG
ALAACLLLGGIDTTGRYLMPEFGEFFFYLAVIAIVCVFPRGLAGRIK