Protein Info for SM_b20786 in Sinorhizobium meliloti 1021

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 125 to 141 (17 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 310 (268 residues), 123.9 bits, see alignment E=3.4e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to sme:SM_b20786)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TN2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SM_b20786 branched-chain amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MATMSEASTALSAGRRGLGRDLAGLAVILVLAGIGYLLFPNNLALLTRITAIALLVLSLD
LVTGYCGVATLGHAALFGSGAYAAGIAAVHFGITDPLLMLAAGILGGALAGLACGVVILR
AHGLPQLVLSIALIHLFHEFANKASSWTGGSDGLAGISPDPLIGLFAFDLWGRTAYVFGV
VLLAIVFVLLRLVVRSPFGMLCRGIREDPTRIRAMGASPTIALLKMYVISGAVAGVGGAL
NAVSTQVVGLDSLSFTLSAESLVMLVLGGTGSLFGALTGTIVFMFFEDLVSTANPFHWLT
MVGALLIAVVLFAPKGLYGTVAEVLARRRGAGR