Protein Info for SM_b20761 in Sinorhizobium meliloti 1021

Annotation: carbon-phosphorus lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF05861: PhnI" amino acids 1 to 351 (351 residues), 544.5 bits, see alignment E=4.6e-168

Best Hits

Swiss-Prot: 100% identical to PHNI_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (phnI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06164, PhnI protein (inferred from 100% identity to sme:SM_b20761)

MetaCyc: 100% identical to alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (Sinorhizobium meliloti 1021)
RXN-17957 [EC: 2.7.8.37]

Predicted SEED Role

"PhnI protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52986 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SM_b20761 carbon-phosphorus lyase (Sinorhizobium meliloti 1021)
MYVAVKGGEAAIANAHRLLADRRRGDRALPAITIDQVVEQLGLAVDRVMAEASLYDRALA
ALAVRQARGDMIEAIFILRAYRTTLPRFGYCEPVDTAKMKVERRVSATYKDLPGGQLLGP
TFDYTHRLLDPSLIGEEPVDEPVLKEPGEHVMRVSDILDGEGLIEGDGKMPEGHVAGDLT
REPMEFPMARDLRLQALARGDEGFLLALAYSTQRGYGRTHPFVGEVRIGEVEVELELPEL
GFAVSLGVIRVTECQMVNQFKGSSRQPPQFTRGYGLVFGQSERKAMSMSLVDRALRTDEF
DEDIVAPAQDQEFVISHADNVQATGFVEHLKLPHYVDFQAELDLVRRMRREHDAAQAGGK
DGMKEAAE