Protein Info for SM_b20760 in Sinorhizobium meliloti 1021

Annotation: carbon-phosphorus lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF05845: PhnH" amino acids 11 to 198 (188 residues), 211.8 bits, see alignment E=3.9e-67 TIGR03292: phosphonate C-P lyase system protein PhnH" amino acids 12 to 196 (185 residues), 197.4 bits, see alignment E=8.9e-63

Best Hits

Swiss-Prot: 100% identical to PHNH_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH (phnH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06165, PhnH protein (inferred from 100% identity to sme:SM_b20760)

Predicted SEED Role

"PhnH protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52985 at UniProt or InterPro

Protein Sequence (200 amino acids)

>SM_b20760 carbon-phosphorus lyase (Sinorhizobium meliloti 1021)
MTAQSQIYSGAFADPVFEAQSVFRSLMDCFARPGIIGRLSTAAAPPAPLGEASGAVALTL
CDHDTPVWLSPALSKSSAPKWIAFHTGAGVTDTKDEPRFAFFEKGAAVPGFDQFALGTQE
YPDRSTTLVVEVEALEGGQPLIGRGPGIKNGIVIAPKGLPDVFLDLWAANRAIFPRGIDL
VLTAREAVLCLPRTTKLERE