Protein Info for SM_b20758 in Sinorhizobium meliloti 1021

Annotation: ArsR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02325: phosphonate metabolism transcriptional regulator PhnF" amino acids 7 to 243 (237 residues), 292 bits, see alignment E=1.7e-91 PF00392: GntR" amino acids 16 to 77 (62 residues), 64.7 bits, see alignment E=4.7e-22 PF07702: UTRA" amino acids 100 to 239 (140 residues), 110.8 bits, see alignment E=4.8e-36

Best Hits

Swiss-Prot: 100% identical to Y6150_RHIME: Uncharacterized HTH-type transcriptional regulator RB1450 (RB1450) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20758)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O86029 at UniProt or InterPro

Protein Sequence (244 amino acids)

>SM_b20758 ArsR family transcriptional regulator (Sinorhizobium meliloti 1021)
MVAKVVERQMGVALWRQIADRIRLAISNGDYDATGMVPPETALAAEFGVNRHTVRSALAA
LAEEGLVRAVQGRGTMIERKDRVSYPISRRTRFSQGLGRQVREIGTELLGHAQVPASGEI
ATALGVPPGTPLIELSTVSSGDGRPLSTAVSYYPAERFARMAEEYAQLGSVTKAFAAHGL
DDYVRVSTEIVARHAEAEELSLLKLSPGAIVMETQSVNADLEGRPVEYSRTRFAADRVKL
RIET