Protein Info for SM_b20754 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF12844: HTH_19" amino acids 28 to 88 (61 residues), 38.7 bits, see alignment E=1.9e-13 PF13560: HTH_31" amino acids 28 to 85 (58 residues), 40.1 bits, see alignment 9.3e-14 PF01381: HTH_3" amino acids 31 to 85 (55 residues), 49.4 bits, see alignment 9.7e-17 PF06114: Peptidase_M78" amino acids 209 to 329 (121 residues), 88.5 bits, see alignment E=7.6e-29 PF09856: ScfRs" amino acids 330 to 486 (157 residues), 218.3 bits, see alignment E=1.2e-68

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 100% identity to sme:SM_b20754)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TQ4 at UniProt or InterPro

Protein Sequence (491 amino acids)

>SM_b20754 hypothetical protein (Sinorhizobium meliloti 1021)
MKHTILRSANCKIAKRAASMAIGKLYIGRKVRDLRDGKRLTQGQFAERIGISTSYLNQIE
NNQRPVSAAVLLALAEKFQIDIAELSSGESDRLLSALSEALSDPLFETYSPSLQELKLVA
QNAPGLAHALISCHQAYRRNSEQLASIDDTIGRGASFVETTPYEEVRDFFHFVDNYIHEI
DMLAETLAGELGLGDGDNHAALAAYLEARHGIRVVRGAAGDEAIRRFDPRARLLTLNPYA
PAATRDFQLALQIAQMHAREEIDRVAGSAGFRTEEAYEICRIGLQNYFAGALILPYQPFL
KAARDLRHDVELLAARFGASLEQVCHRLSTLQRPGQKGIPIFFARIDRAGNITKRHSAAK
LQFARFGAACPLWNVHQAFETPGRIIRQLAETPDGVRYLCLATQTTKGGGGYRAAHPRYA
LALGCEISYADAFVYADDMDLGNRAAYDPIGISCRICERTRCASRAVPPLKRKLIVDHDM
RGALPYRLSES