Protein Info for SM_b20752 in Sinorhizobium meliloti 1021

Annotation: 3-hydroxyisobutyryl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00378: ECH_1" amino acids 13 to 194 (182 residues), 94.5 bits, see alignment E=6.8e-31 PF16113: ECH_2" amino acids 19 to 337 (319 residues), 401.9 bits, see alignment E=2.9e-124

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to sme:SM_b20752)

MetaCyc: 42% identical to steroid enoyl-CoA hydratase (Mycobacterium tuberculosis H37Rv)

Predicted SEED Role

"3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 3.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 3.1.2.4 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TQ6 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SM_b20752 3-hydroxyisobutyryl-CoA hydrolase (Sinorhizobium meliloti 1021)
MEMQTTLPEVIVERQGAIGRLRLNRPRALNSLNRTMIRAIAAALTEFERNPEIAAVLVTG
EGERGLCAGGDIRMIYESGRERPGEGAQFWREEFIVNSRISAYSKPYIAIMDGIVMGGGV
GVSSHGSHRVVTERTRFAMPETGIGYFTDVGATWLLPRAPGEFGTYLGLTGRDIGAAAVI
HARLADSFVPSEMIGELLGALSSLSGSATADDVSAAIRAVSSEPPASALLDHLSVIDRCF
AFNAVEEIFAALEKDESDFARETLELLKTRSAISLKLTLSLLREGRSSATLNECLEREYA
ATLGMLSNPDFYEGVRAAVIDKDRNPKWSVGLSEATPELLARFGRNDGAPLFAGKE