Protein Info for SM_b20714 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 328 (269 residues), 148.3 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 38% identical to MGLC_HAEIN: Galactoside transport system permease protein MglC (mglC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20714)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TS7 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SM_b20714 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MNTNVAAQGTGSSLARSRRRMPPELNIFLVLIGIALVYEVLGWLFVGQSFLMNSQRLTIM
ILQVSVIGIIAVGVTQVIITGGIDLSSGSVVGMTAMISASVAQASTWPRALYPSLTDLPA
IVPIGLGVGIGLLAGFINGQLIARTKIPPFIATLGMMVSARGVSKWYTKGQPVSGLTEQF
NFIGTGIWPVIVFLVVALIFHIALRYTRYGKFTYAIGANVQAARVSGINVEAHLVKVYAI
AGMLAGLAGVVTAARAQTAQAGMGVMYELDAIAATVIGGTSLTGGVGRVTGTVIGTVILG
VMTSGFTFLRVDAYYQEIVKGIIIVAAVVVDVYRQKGRKKT