Protein Info for SM_b20699 in Sinorhizobium meliloti 1021

Annotation: protein secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details PF16576: HlyD_D23" amino acids 67 to 309 (243 residues), 63.8 bits, see alignment E=2.1e-21 PF13533: Biotin_lipoyl_2" amino acids 67 to 114 (48 residues), 54.5 bits, see alignment 1.2e-18 PF13437: HlyD_3" amino acids 233 to 313 (81 residues), 55 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to sme:SM_b20699)

Predicted SEED Role

"Multidrug resistance protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TT9 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SM_b20699 protein secretion protein (Sinorhizobium meliloti 1021)
MESLEEKVAIITGARSGNGVAVARPNRKKMIGLALCLGAVVVVVAGWTWARESGAASTDN
AYVRGDVTSLAPKVAGYVTAVEVEDNQAVRAGDVLFRIDDRDYRAKLAQAVANVEAAEAR
LTNVDAEMALQHALIRQAEAQRRSVVAELNLAAKAYDRRRELIRSETISQAHVDESDAAK
SRAEANVLAASATVEAQQQRIAVLAAQREAAVAAVAQAEAARDLAGIDLESTVVRAPVGG
VIGNRQVRVGRLVAPGASLLDIVPLDNVWIVANFKETQLEHIRPGQRASITIDGYKSGAL
EGVVDSFAPGSGSAFSLLPADNATGNFVRVVQRVPVKIRFAGNPLSGRLLPGLSARVEID
LEGGS