Protein Info for SM_b20698 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 55 to 77 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 276 to 302 (27 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 415 to 425 (11 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 420 (399 residues), 110.3 bits, see alignment E=5e-36

Best Hits

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to sme:SM_b20698)

Predicted SEED Role

"FIG01074225: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TU0 at UniProt or InterPro

Protein Sequence (550 amino acids)

>SM_b20698 transporter (Sinorhizobium meliloti 1021)
MTIATATPSRDISMAGGLLVAGIVLATLTEAIASTVLSLGRGDIIGDTYATPDEFAWLDV
GYTTFKLIGFMAASWLMSRFDPRNLVVGSTLAMGMACGIAAMTARLDLLVALRMIQGFSG
GTLLVGGQAIIFLTFPHSRQPLLQAFFAMGSVVAPATIAPALQGLLLDSQSWTWIFFSII
PLALAAAGLLLLADGPVATRAQRRPFDWIGFSLISAALFCFTYVFSQGSRWDWFEEPRIL
WLAVIGTATLLAFLGQQVLAKGQGLFDFTLFETEDFCFAFIVSFVAGAALFGSAFLIPSF
AVSVLAFTPTDAGQLLLPSGALFIGALLIAAFLMQLRRVPPVATVPFGILMIMAAMWMLS
GSTSESGAGDMMAAILLRGAGLGFLFLSITLIAFSNLNSRNLASGIGLFNTGRQLGGLIG
VSALQTLIEHNVSHNLAVLGANVTAGAPAVADRLTTTAALLTAKGMDAAAASRGAASLLG
RAVAGQSTVIAFDTAFNAIGLLFVIAAPVLVGIKIGLARYAKARAEKGRAGVAAKPSGHH
TLPIKRVPAS