Protein Info for SM_b20682 in Sinorhizobium meliloti 1021

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF09339: HTH_IclR" amino acids 24 to 73 (50 residues), 51.6 bits, see alignment 6.6e-18 PF01614: IclR_C" amino acids 98 to 261 (164 residues), 142 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 34% identical to ALLR_SALTY: HTH-type transcriptional repressor AllR (allR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13641, IclR family transcriptional regulator, acetate operon repressor (inferred from 100% identity to sme:SM_b20682)

Predicted SEED Role

"Negative regulator of allantoin and glyoxylate utilization operons" in subsystem Allantoin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TV6 at UniProt or InterPro

Protein Sequence (273 amino acids)

>SM_b20682 IclR family transcriptional regulator (Sinorhizobium meliloti 1021)
MEAKGKGKRGRKAGENAAPASVQVLDRSLSLLAIIAEGDGSTLTALSERSGMAPSTVHRL
LTSLAQHEMVANDAEAGTWTVGVKAFEIGNAFLRFRKLGTISRPFLKRLMDESGETANIG
IEEDGDVVFISQVESHAPMRAFFRPGRRGPIHASGIGKAILSTWSDTEIAKTLSGRTLAC
FTGRTLATLPDLIRNVQEIRFRGWSVDDEEHTLGMRCIAAPLFNEYGEAIGGISISGPTV
RIDDERLGVLGPAVRRMADELTRAIGGHRPEEG