Protein Info for SM_b20661 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 117.5 bits, see alignment E=1.8e-37 PF17912: OB_MalK" amino acids 235 to 284 (50 residues), 41.2 bits, see alignment 6.2e-14 PF08402: TOBE_2" amino acids 279 to 345 (67 residues), 35.6 bits, see alignment E=2.1e-12 PF03459: TOBE" amino acids 289 to 344 (56 residues), 30.5 bits, see alignment E=8.5e-11

Best Hits

Swiss-Prot: 56% identical to Y2787_BRUAB: Putative ATP-binding protein BruAb2_0487 (BruAb2_0487) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4367)

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TX6 at UniProt or InterPro

Protein Sequence (355 amino acids)

>SM_b20661 sugar uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MAGVDFVDVRKSFGAFPVIKGVNIEIEDGEFVILVGPSGCGKSTLLRMLAGLENITAGEI
RIGNQVVNRLPPKDRDIAMVFQNYALYPHMTVADNMAFSLMLAARPKSEIDKRVGVAAEI
LGLSKLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRAEIKELH
QRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGAPLELYDNPANLFVAGFIGSPAMN
MLKGRLDPADPSVFLTADGTALPVARPAAAAQGRDLVYGLRPEYMALDPNGLPAEIAVIE
PTGYETQLIARLGGHDVTCVFRERVNAKPGETIHLAIDAAHVHLFDAGTGRRLVA