Protein Info for SM_b20650 in Sinorhizobium meliloti 1021

Annotation: long-chain fatty acid CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 PF00501: AMP-binding" amino acids 9 to 371 (363 residues), 319.9 bits, see alignment E=3.2e-99 PF23562: AMP-binding_C_3" amino acids 413 to 480 (68 residues), 22.6 bits, see alignment E=1.7e-08 PF13193: AMP-binding_C" amino acids 427 to 501 (75 residues), 75.4 bits, see alignment E=8.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20650)

Predicted SEED Role

"Small Molecule Metabolism; Fatty acid biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TY5 at UniProt or InterPro

Protein Sequence (515 amino acids)

>SM_b20650 long-chain fatty acid CoA ligase (Sinorhizobium meliloti 1021)
MRFEQFLIRNAAANGAKTALVTDRRRLGYAELDDLSTRLAAAFAENGVKRNDRVLVFMDN
CWEAAAAIFAILKAGATFSPINASTKADKLAYIVADCEAAAILTQAKLMPVVAEALALAP
GHAPFVASTAAPGGRIPDGAASFEECLTAAPAPVRHGGIDVDLGMLIYTSGSTGRPKGVM
MTHRNIDAASESITTYLRNTPDDIILNVLPLAFDYGLYQLLMAIRLGATLVLEKSFAFPQ
AIFDRIRTERVTGFPLVPTMAAMILQMRDLEPGFLPSLRYLSNTAAALPPAHIARLRELF
PGARLYSMYGLTECKRCTYLPPEELDRRPGSVGIAIPNTEAFVVDDEGNRVPPGVPGELV
IRGPHVMQGYWRNDAATERMLRPGPNPWEKVLHTGDLFRTDEEGFLYFVGRKDDIIKTRG
EKVAPKEVETVLHAHPGIAEAVVIGVPDPVLGAAIGALVVLSDPTLTEKDIIRHCSRHLE
DFMVPKIVEFRTELPKTDTGKVSRRLAAETLEPAE