Protein Info for SM_b20649 in Sinorhizobium meliloti 1021

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02540: NAD_synthase
  • amino acids 26 to 112 (87 residues), 60.9 bits, E=5.5e-21
  • amino acids 175 to 308 (134 residues), 101.7 bits, E=1.8e-33
• TIGR00552: NAD+ synthetase
  • amino acids 174 to 299 (126 residues), 101.1 bits, E=3e-33

Best Hits

Swiss-Prot: 100% identical to NADE_RHIME: NH(3)-dependent NAD(+) synthetase (nadE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to smk:Sinme_4379)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

See Q92TY6 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SM_b20649 NAD synthetase (Sinorhizobium meliloti 1021)
MNIRPDQNRLVFSADTLKIDEAAEADRIVAGLRAQLRSLRKRGLVLGLSGGIDSSVSVAL
AVRAVGAKNVFCLFMPENDSDPESLRLGRLVAETFGVEAVVEDIGPTLDAMGCYQRRDAF
IRELVPDYGPGWASKIVIANALEGDGYNISSLVVQDPEGKQTKLRMPPSVYLGIVAATNM
KQRTRKQIEYYHADRLNFAVLGTPNRLEYDQGFFVKNGDGAADVKPIAHLYKSQVYALAG
HLGIPEEIRRRPPTTDTYSLEQTQEEFYFSLPYDRMDLCLFGLNNGLSADEVGRAANLGV
AQVKRVWADIAAKRKATRYLHLGPQLVQPVEEIE