Protein Info for SM_b20633 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 296 (186 residues), 65.8 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4198)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TH3 at UniProt or InterPro

Protein Sequence (305 amino acids)

>SM_b20633 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTTSALTSATRRRRPKRQAGWRGLIYIAPAMALVTLFFVLPVLFTLWMSLHKWPLLGEPA
WIGLRNYTRMFTDARFFNALGFTAHYTLIVTIAIFAVAFPLAIFVEKQRPLVSLYRTIVF
LPVVVGLASASLLWVWLANVDSGLFAPLFDMLGLTSGRINLLAKFDTAFLTIIVMVVWKI
AGFTMIILLTGLQAIPAELTEAARIDGAGRWQRFRHLTLPLMRRTMALALILSVTGSILA
FDQFYIMTSGGPQNKMISVVYYIFNQSFVSFNLGYGAALSIALLLILVTLSVVQLWLLKV
GDERP