Protein Info for SM_b20630 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00005: ABC_tran" amino acids 26 to 167 (142 residues), 125.1 bits, see alignment E=4.8e-40 PF17912: OB_MalK" amino acids 241 to 289 (49 residues), 41.7 bits, see alignment 2.6e-14 PF08402: TOBE_2" amino acids 282 to 352 (71 residues), 45.4 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 55% identical to UGPC_RHOS1: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4201)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TH6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>SM_b20630 sugar uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MANGISNKSVVLSDIRKSYGGLEVIHGIDLTIEEGDFVVFVGPSGCGKSTLLRMIAGLEE
VSEGEIAIKGRDVTDLDPSERGIAMVFQSYALYPHMSVSENLGFGLKMARTDPAEIARRV
AQVSAILKIDHLLDRRPGQLSGGQRQRVAIGRAIVRKPDVFLFDEPLSNLDAELRVSMRI
EIARLHRELGNTMVYVTHDQTEAMTLADQIVVLRDGRIEQAGSPRDVYEDPANMFVAGFI
GSPRMNFLDAEWQGDGTIRVGETTLEAAIDGGSLKHGERLLLGIRPEHIAVAEPGPERIA
AQVEFSEYLGGTRYLYCQLEDGQSLVVEQREGPNWQAGEKLSFAVPDDRRRFFAEDGRRL
R