Protein Info for SM_b20623 in Sinorhizobium meliloti 1021

Annotation: methylthioribose kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF01636: APH" amino acids 36 to 275 (240 residues), 88.6 bits, see alignment E=5.9e-29 TIGR01767: S-methyl-5-thioribose kinase" amino acids 38 to 418 (381 residues), 556.1 bits, see alignment E=2.3e-171 PF01633: Choline_kinase" amino acids 211 to 277 (67 residues), 23.9 bits, see alignment E=2.9e-09

Best Hits

KEGG orthology group: K00899, 5-methylthioribose kinase [EC: 2.7.1.100] (inferred from 100% identity to smk:Sinme_4207)

Predicted SEED Role

"5-methylthioribose kinase (EC 2.7.1.100)" in subsystem Methionine Salvage (EC 2.7.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TI3 at UniProt or InterPro

Protein Sequence (423 amino acids)

>SM_b20623 methylthioribose kinase (Sinorhizobium meliloti 1021)
MDKQVFEALSAESLPHRLGGNSALREKIGGDVSHWTVKEIGDGNLNLVFIVTGSKGTAVV
KQALPYVRLVGESWPLPLKRSFFEYHALVRQAARAPGMVPEIFFFDETQALIVMEYLTPH
VILRRALIDGRELPNIGCDLGLFAARTLFRGSDLSMATRDKKADLALFADNVELCDITEN
LVFSDPYFEADLNRHTAPQLDPIVMELRSDRDLKVEAQRLKHLFSAKAETLCHGDLHTGS
VMVTDAETRVIDPEFAFYGPISFDVGMLLANFWMSYFSQSGQESTTGARDGMRAYLLETI
ETIWETFRSEFAQLWRTERMGILYQARVFEDRNDPLGAEQALNIVIDDIWREMLGFAGIE
IHRRILGLAHNADFETIADPDRRAACESKALKLGRHLAVNRHRIHSLRDIRATAERLQKE
TLA