Protein Info for SM_b20613 in Sinorhizobium meliloti 1021

Annotation: C4-dicarboxylate transport transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 104.6 bits, see alignment E=1.1e-33 PF00158: Sigma54_activat" amino acids 145 to 311 (167 residues), 219.7 bits, see alignment E=6.1e-69 PF14532: Sigma54_activ_2" amino acids 146 to 316 (171 residues), 60.8 bits, see alignment E=5.6e-20 PF07728: AAA_5" amino acids 168 to 285 (118 residues), 30.7 bits, see alignment E=8.7e-11 PF25601: AAA_lid_14" amino acids 317 to 376 (60 residues), 67.8 bits, see alignment E=1.8e-22 PF02954: HTH_8" amino acids 398 to 437 (40 residues), 24.2 bits, see alignment 6.8e-09

Best Hits

Swiss-Prot: 100% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to sme:SM_b20613)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein dctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P13632 at UniProt or InterPro

Protein Sequence (460 amino acids)

>SM_b20613 C4-dicarboxylate transport transcriptional regulator (Sinorhizobium meliloti 1021)
MSAAPSVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPG
MDGLALFRKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAE
EKRRLVMENRSLRRAAEAASEGLPLIGQTPVMERLRQTLKHIADTDVDVLVAGETGSGKE
VVATLLHQWSRRRTGNFVALNCGALPETVIESELFGHEPGAFTGAVKKRIGRIEHASGGT
LFLDEIEAMPPATQVKMLRVLEAREITPLGTNLTRPVDIRVVAAAKVDLGDPAARGDFRE
DLYYRLNVVTLSIPPLRERRDDIPLLFSHFLARASERFGREVPAISAAMRAYLATHSWPG
NVRELSHFAERVALGVEGNLGVPAAAPASSGATLPERLERYEADILKQALTAHCGDVKET
LQALGIPRKTFYDKLQRHGINRADYVERAGPGRPNAISKT