Protein Info for SM_b20610 in Sinorhizobium meliloti 1021

Annotation: two-component response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00072: Response_reg" amino acids 13 to 125 (113 residues), 101 bits, see alignment E=4.6e-33 PF00196: GerE" amino acids 248 to 302 (55 residues), 65.7 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20610)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TJ1 at UniProt or InterPro

Protein Sequence (309 amino acids)

>SM_b20610 two-component response regulator protein (Sinorhizobium meliloti 1021)
MPVPEAANARDIVLLVDDSPEALGFLTEALEQSGFSVLIATSGNAALNIADRITPDIILL
DAVMPGMDGFDTCTRLKANASVAQVPVVFMTGLTETEHVVRALEAGGVDYLTKPINIDEL
RARIRVHLSNARSAQSARVALDAAGRHLLAVRGDGTVRWSTPQATRLVNAATGSDDGLAF
VAGRIAEWMRERENSPGERQGTFTLQRASQTGLQISYLGAIGANEYLFRLTAENGMSDDE
TLRQHFRLTQRESEVLLWIAKGKSNRDIGEILGLSARTVTKHLEQIYVKLGVENRASAAV
KATQVLHGI