Protein Info for SM_b20583 in Sinorhizobium meliloti 1021

Annotation: 4-hydroxybenzoate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02360: 4-hydroxybenzoate 3-monooxygenase
  • amino acids 1 to 390 (390 residues), 681.2 bits, E=2e-209
• PF01494: FAD_binding_3
  • amino acids 2 to 343 (342 residues), 351.5 bits, E=2.8e-109

Best Hits

Swiss-Prot: 64% identical to PHHY_PSEFL: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas fluorescens

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 100% identity to sme:SM_b20583)

MetaCyc: 64% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-chlorobenzoate degradation (1/4 steps found)
• 4-methylphenol degradation to protocatechuate (1/4 steps found)
• 4-coumarate degradation (aerobic) (1/5 steps found)
• bisphenol A degradation (1/5 steps found)
• 4-hydroxymandelate degradation (1/6 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (7/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

See Q92TL6 at UniProt or InterPro

Protein Sequence (390 amino acids)

>SM_b20583 4-hydroxybenzoate 3-monooxygenase (Sinorhizobium meliloti 1021)
MRTQVVIIGSGPSGLLLGQLLTEAGIANVILDRATKAHILGRVRAGVLEQGTVRLMEEAG
CGARMHAEGLPHDGFSLAFDGRDHRIDLFGLTGGRRVMIYGQTELTRDLMDHRERVGALS
IYEAANVMPRDFDGRTPHVAYEKDGIAQRIDCDFIAGCDGFHGVSRRSLPEKAIRNFEKI
YPFGWLGILADVPPVDHELVYANHPRGFALCSMRSHTRSRYYIQCPLEEKIEDWDDQRFW
DELRRRLPAHHAERVVTGPSFEKSIAPLRSFVAEPMRFNRLFLAGDAAHIVPPTGAKGLN
LAASDVHYLFEGLLEHYQDRSNAGIDAYSARALARVWKAVRFSWWMTTMLHRFPETSDFD
QRIQEAELDYLTHSRAAATALAENYVGLPF