Protein Info for SM_b20571 in Sinorhizobium meliloti 1021

Annotation: aliphatic sulfonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 197 to 223 (27 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 273 (170 residues), 100.3 bits, see alignment E=5.9e-33

Best Hits

Swiss-Prot: 37% identical to Y4188_BRUSU: Probable ABC transporter permease protein BRA1188/BS1330_II1179 (BRA1188) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to smk:Sinme_4259)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TM8 at UniProt or InterPro

Protein Sequence (281 amino acids)

>SM_b20571 aliphatic sulfonate ABC transporter permease (Sinorhizobium meliloti 1021)
MSLQELDRSIIHEGGSVSAKADEYLRRSGAAAGSWLSRYGLLIAFLALWQAASTAGWINP
AVFPSVGAILSALWTGISGGALLDDIAISLQRSGTAFVGAVVLAIPLGLLMGQVRAIENA
LDPVLQLFRQTSALALYPVFILLLGLGEASKVFVIFWATLFPLLLSTISGVKEVDSKLIE
MARVYGASRLTVFRRVVLPGAVPSIFVGLRLSATTALLLLIASEMIGANKGIGFQVMNAQ
YNFQIPLMFAAIFILAGLGLVSNYALVFAQRRLCRWSDASN