Protein Info for SM_b20486 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 255 to 285 (31 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 311 (274 residues), 115.3 bits, see alignment E=1.5e-37

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20486)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W77 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SM_b20486 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MRSLIRTHATEFSLLAVIVVISTVLSFATANFFSLGNAFDLLNISAVNIIFAVGLLVVLI
AGGIDISFAVAASVVQYGTAIALGWIGGGGWISGLLIAGSLGVLLGCFNAFLIHRFRIIS
IVATISTFNIYFGLLMFFTRGVSIYDLPDWLTDRVILFEREMPDGTWIEITLPVLVMIVC
VIATWTLITRTTTGRQLYAFGDNPEGARRFGINIGAMQFIAFGWLGLMAGIGGLIQAHYA
QEVVPNALYGRELDVLAAVVLGGARLGGGKGTVLGCVLGVLLISITQNGLNLMGVSPFAF
KMIIGAIILIAITLSSTRIERLLPFVGQKGTGR