Protein Info for SM_b20479 in Sinorhizobium meliloti 1021

Annotation: dipeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 33 to 183 (151 residues), 121.4 bits, E=4.3e-39

Best Hits

Swiss-Prot: 43% identical to OPPF_LACLA: Oligopeptide transport ATP-binding protein OppF (oppF) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SM_b20479)

MetaCyc: 47% identical to nickel ABC transporter ATP binding subunit NikE (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

See Q92W84 at UniProt or InterPro

Protein Sequence (265 amino acids)

>SM_b20479 dipeptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTGAAIQVRDLCKTFGGGRSFFGKAKHEIRAVKAVSLDVARGETLAVVGESGSGKSTLAR
MLVGLEEPTSGSMLIAGRDAAALRRSGPRAFGKTIQYVFQDPVASLNPRKTIQEILETPL
KLLCGYEAPRRRARMQELLHAVQMPEDTLLRYPHEFSGGQAQRIAIARALATEAEIIVLD
EPVSALDVSIQAQVLLLLRDLKQRFGLSYLFISHDLAVVEAISDRVAVMYFGEVVETAPA
ARLFTDPEHAYTRQLVASAPRIRKE