Protein Info for SM_b20478 in Sinorhizobium meliloti 1021

Annotation: dipeptide ABC transporter permease and ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 135 to 166 (32 residues), see Phobius details amino acids 206 to 233 (28 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 291 (184 residues), 105.8 bits, see alignment E=3.5e-34 PF00005: ABC_tran" amino acids 340 to 499 (160 residues), 96.7 bits, see alignment E=2.8e-31 PF08352: oligo_HPY" amino acids 550 to 589 (40 residues), 33.5 bits, see alignment 6.6e-12

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02034, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SM_b20478)

Predicted SEED Role

"Probable oligopeptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W85 at UniProt or InterPro

Protein Sequence (600 amino acids)

>SM_b20478 dipeptide ABC transporter permease and ATP-binding protein (Sinorhizobium meliloti 1021)
MSALAASPAPRRGSGRITSWHLLLNNRLATGGLVLLGLILLLIVLVPILPLPDPDATAPV
NRLQPVLTAGHLLGTDQLGRDILSRLLWGTRVSIAVGFAATLIAAGIGSAIGIIAGYAGG
RTDNAMMRGIDMLMAFPYILLALAIVAALGPGLMNALYAIALVNIPFFARNVRGVTLGYA
HSEFVDAARLSGKGHLSVILTEVLPNVMPVIVITMSTTAGWMILETAGLSFLGLGAQPPQ
ADLGSMLGEGRAQLFTAPHVSVVPGAMIFLIVISLNVLGDGIRDVLDPRLRSGALARPAP
VTEVAPDRTAPANTAEGACLAIEKLETGFRRGKEIIPAVRDVSLHVKPGECLGLIGESGS
GKSVTALSVMGLVASPPGVIRNGAVYLGNDDVLSMPETRLIAKRGSRLAYVFQDPLTTLH
PMYPVGRQVEEAIAAHQQVRAAERREKAVALLEKVGIPDARERSVHYPHQLSGGQRQRVG
IAMALANDPEIIIADEPTTALDVTVQARILELLRDLQREQGMALLFITHDFGIVSEFCDR
VAVMKDGEIVETGKTREVLANPQHPYTKRLIACVPELGTGERFLDRVAGLFAGGKAEVAQ