Protein Info for SM_b20449 in Sinorhizobium meliloti 1021

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF01209: Ubie_methyltran" amino acids 100 to 227 (128 residues), 65.1 bits, see alignment E=2.3e-21 PF13489: Methyltransf_23" amino acids 117 to 249 (133 residues), 45.5 bits, see alignment E=2.5e-15 PF07021: MetW" amino acids 117 to 215 (99 residues), 25 bits, see alignment E=4.7e-09 PF13847: Methyltransf_31" amino acids 119 to 226 (108 residues), 62.6 bits, see alignment E=1.3e-20 PF13649: Methyltransf_25" amino acids 125 to 218 (94 residues), 65.7 bits, see alignment E=1.8e-21 PF08241: Methyltransf_11" amino acids 125 to 222 (98 residues), 66.2 bits, see alignment E=1.2e-21 PF08242: Methyltransf_12" amino acids 125 to 220 (96 residues), 44.4 bits, see alignment E=7.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20449)

Predicted SEED Role

"Small Molecule Metabolism; Biosynthesis of cofactors, carriers; menaquinone, ubiquinone"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WB2 at UniProt or InterPro

Protein Sequence (352 amino acids)

>SM_b20449 methyltransferase (Sinorhizobium meliloti 1021)
MLKGAIEEVRGVLYINVKRLVQMNNTAYHAFARVLLDACRTRSDIRFVVVTSSVVGWTER
MFAHLNKIEPQVTVEVYDSKFYPGQSFVENTSFIPILRTQTKMTWRHERKILPRHGLRPG
MTMADICCGIGDFAMLVRKEFQPARIVALDHSKASLAYARDVASGFGVTDIEYTYGDASE
MLLEDNQFDFVTCRHSLQIFNQPDVLLKELFRICKPGGRVYITNEKNSHCLGEPRAQSIQ
WTYNEVARLFSHFEMDVEFGPKSKRYLVDAGFDDISVESFMVTNLDGDPQDFADIIAAWE
NVYAGEMAVKRGDPPEFIERFRQGFRDHIFAALHPKGYAGWPIWAASGRKPL