Protein Info for SM_b20443 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details PF04290: DctQ" amino acids 44 to 171 (128 residues), 96.7 bits, see alignment E=5.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3741)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WB8 at UniProt or InterPro

Protein Sequence (190 amino acids)

>SM_b20443 permease (Sinorhizobium meliloti 1021)
MSQEVHLQTTPEEIAHAFDEAPPAADLSNYAFEDWVTLAVFWLMAGCVFLQFFTRYVLND
SYAWTEEIATNCLIGVVFLGSVMCVRLSRHIQVDVLYHYLPLPVARALAIFVDLVRIVFF
AYACWLMWRYVAIVAHERMVTVDLPRNIVFYSVMAGFVLMLIRSIQVFVANQRRGYSVLE
KPEEFHKVED