Protein Info for SM_b20431 in Sinorhizobium meliloti 1021

Annotation: arylmalonate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02990: ectoine utilization protein EutA
  • amino acids 16 to 254 (239 residues), 462.9 bits, E=1.1e-143
• PF17645: Amdase
  • amino acids 79 to 251 (173 residues), 81.9 bits, E=2.8e-27

Best Hits

KEGG orthology group: K01799, maleate isomerase [EC: 5.2.1.1] (inferred from 100% identity to sme:SM_b20431)

Predicted SEED Role

"Arylmalonate decarboxylase (EC 4.1.1.76)" (EC 4.1.1.76)

MetaCyc Pathways

• nicotinate degradation I (2/6 steps found)
• nicotinate degradation II (1/5 steps found)
• picolinate degradation (2/7 steps found)
• nicotine degradation II (pyrrolidine pathway) (3/11 steps found)
• nicotine degradation III (VPP pathway) (2/10 steps found)
• superpathway of nicotinate degradation (2/18 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.76 or 5.2.1.1

Sequence Analysis Tools

See Q92WC5 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SM_b20431 arylmalonate decarboxylase (Sinorhizobium meliloti 1021)
MRTAVALSLAARRPRLDDRPLDKRIGLVILATDHTTEVDFQRMVASDRIGVYVTRIPYAN
PVTPENLRAMQPSLTEAAALILPDETLDVVMYSCTSASVVIGDREVAAAIKAAKPEAAVV
TPTAASVQGLRALSANRISVLTPYTIETSRPMADYFAERGFAIDRFTCLGLTDDREMARI
SPKEIVAFAKEAAAPASDALFISCTAVRAAGVIAEIEQAIGKPVVSSNYATAWACLRLCG
DREARPQLGRLMELPLEEERP