Protein Info for SM_b20425 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13412: HTH_24" amino acids 3 to 50 (48 residues), 67.3 bits, see alignment E=1e-22 PF13404: HTH_AsnC-type" amino acids 3 to 44 (42 residues), 55.8 bits, see alignment E=4.8e-19 PF01037: AsnC_trans_reg" amino acids 70 to 143 (74 residues), 69.6 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 51% identical to DOEX_HALED: Transcriptional regulatory protein DoeX (doeX) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_3755)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WD1 at UniProt or InterPro

Protein Sequence (164 amino acids)

>SM_b20425 transcriptional regulator (Sinorhizobium meliloti 1021)
MKLDAIDLRILEAIQADGRITKLALAEKAGLSPTPCWMRLRKLEKAGIVTGYHARVALRR
VAPVASVMMEVTLGNHRQADFDRFERAIAAIPEIVACWSVGGGVDYILKIMTADIDAYQR
LVDGLLERELGIDRYFTYIVTKTVKEETVLPFGSLLPQAPAGQE