Protein Info for SM_b20388 in Sinorhizobium meliloti 1021

Annotation: NADPH:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 248 to 268 (21 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 85 (58 residues), 31.7 bits, see alignment E=1.8e-11 PF00107: ADH_zinc_N" amino acids 154 to 272 (119 residues), 71.2 bits, see alignment E=1.3e-23 PF13602: ADH_zinc_N_2" amino acids 187 to 322 (136 residues), 55.2 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to sme:SM_b20388)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WG5 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SM_b20388 NADPH:quinone oxidoreductase (Sinorhizobium meliloti 1021)
MRAAWYGKNGAARDVLEVGGLPDPLPGPGEVRVRIHASGVNPSDVKARAGRPLIAPRMIP
HSDGAGIIDAVGTGVAGERIGERVWTWNAAWRRSNGTAAEYVVLPQDQAVHLPDNVSFEE
GACLGIPALTALRAVTTDGGVFGKTVLVTGGAGAVGAYAIQFARLYGAACIITTVSSSEK
AEICTRLGADHTINYRTEEVVDRIGGITHGRGVDRVIEVDAATNVAMLPGIIARDGLCVI
YGSSKPVVSFEFFPMILAGAAARFFIVYEMSPEARTETVSALQGQLASGLLRHHIAGTYA
LDDIAAAHEAVESGKTIGNVVVSLGQ