Protein Info for SM_b20382 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 58 to 88 (31 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 169 (27 residues), see Phobius details amino acids 193 to 225 (33 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 270 (189 residues), 47.9 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SM_b20382)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WH1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>SM_b20382 ABC transporter permease (Sinorhizobium meliloti 1021)
MKHRTSPVLVEGPMPLMAPAVIFLALFFLVPLGYVIWMSLSQPVIGLQNFGRLLNSSLFA
SVLYNTFKTALLVTLLSLLFAYPLAYAAANGSKRFATFLLTVVALSFWTSYLVRTYAWMV
ILGNQGPVTALLSWFGWDPTPKILFTTFSATLAMTHALIPFMTMSLFAVMKRIDPLYVRA
AENLGAHPFRAFVSVYLPLSAPGIVNGCTLVFITCLGFYVMPVLLGSPRDQMIAGIIGDQ
IEQTLDFGLGSAISIVLLALTLAVYGLYNRFFGLDRLWAGGDR