Protein Info for SM_b20351 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00005: ABC_tran" amino acids 29 to 178 (150 residues), 108.8 bits, see alignment E=3.4e-35 amino acids 283 to 437 (155 residues), 72.9 bits, see alignment E=4.1e-24

Best Hits

Swiss-Prot: 40% identical to RBSA_PHOPR: Ribose import ATP-binding protein RbsA (rbsA) from Photobacterium profundum (strain SS9)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to sme:SM_b20351)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WK2 at UniProt or InterPro

Protein Sequence (516 amino acids)

>SM_b20351 sugar ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MIMHPADDDDCVLRLEDVTKVYSGIIAVRHANLSLRRGAVNVLVGENGAGKSTLMRIIAG
VEKPSLGRILLDGQQVEFHSPADAQRHGIGMVFQELNLFGNLSVAENIFATRELTRGIRG
IDHRAQVERATGFLDRLDAGIDAETLVEDLPIGQQQLVEIAKAISLDTRILILDEPTSAL
SAAEVDVLFKVIRELKAQGVAIVYISHRLEELMRIGDYITVLRDGQITGHAMVKDIDTKW
IVRSMIGSDAKDFAKSVDHRLGEEAFRAEEICLPRRTGGLAVDHVSISVRAGEVLGIYGL
MGAGRSEFFECVMGQHPHSSGRVFVGGTEVDASDTSGRISAGLALIPEDRQREGLVQALS
IASNLTLASLDRFVRFGFHIVGAREQASIAAAIRDLSIKAPNPDFEVTSMSGGNQQKVVI
GKALMTKPKVLLMDEPSRGIDVGAKADVFRTMRRLAGEGLAILFSTSDLEEVMALSDRIA
VMSNGRLVTVIDRADATEEMIIKASAEGHKTTREHA