Protein Info for SM_b20330 in Sinorhizobium meliloti 1021

Updated annotation (from data): glucoside 3-dehydrogenase; active on raffinose or trehalose (thuB) (EC 1.1.99.13)
Rationale: Specifically important for: D-Raffinose pentahydrate; D-Trehalose dihydrate. a close homolog is described by PMID 23772075
Original annotation: trehalosemaltose utilization protein, function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 7 to 124 (118 residues), 85.5 bits, see alignment E=7e-28 PF22725: GFO_IDH_MocA_C3" amino acids 134 to 275 (142 residues), 92.8 bits, see alignment E=2.5e-30 PF02894: GFO_IDH_MocA_C" amino acids 137 to 348 (212 residues), 60.9 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3849)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.13

Use Curated BLAST to search for 1.1.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANR7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SM_b20330 glucoside 3-dehydrogenase; active on raffinose or trehalose (thuB) (EC 1.1.99.13) (Sinorhizobium meliloti 1021)
MKGTPMRLLILGTGGMANSHAKAFAEIEGVEMVGAVDVDPSRAKAFAVTHGIENTFTSLD
DAIAWGEFDAATNVTPDKAHHPTTLALIAAGKHVLCEKPLAENYEKAAEMAAAAERAGLV
TMVNLTYRNVAPLQKARELVVAGEIGRVRHLEASYLQSWLVSRAWGDWASESKWLWRLST
KHGSNGVLGDVGIHILDFAGYGANSSVERVFARLKAFDKAPDNRIGEYDLDANDSFAMTA
EFENGAMAVIHASRWATGHLNELRLRLHGDRGALEVIHTPDGSSLRGCMGPDVEKAVWRT
VDAGTVPTNYQRFVEAVKAGRTVEPGFRHAADLQRVLDLAIETERSRRELGVPDIDAVVQ
ERAVG