Protein Info for SM_b20325 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-trehalose/D-maltose/sucrose, substrate-binding component (ThuE)
Rationale: Specific phenotype on trehalose, but also reported to transport maltose and sucrose (PMID:12003938; also PMC1635973)
Original annotation: trehalosemaltose-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 39 to 333 (295 residues), 146.1 bits, see alignment E=3.7e-46 PF13416: SBP_bac_8" amino acids 46 to 358 (313 residues), 120.1 bits, see alignment E=2.4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3854)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANS2 at UniProt or InterPro

Protein Sequence (423 amino acids)

>SM_b20325 ABC transporter for D-trehalose/D-maltose/sucrose, substrate-binding component (ThuE) (Sinorhizobium meliloti 1021)
MNVKPFVRTLISCAAIAGAIDLAAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLV
TMPASSSEQFSQYRLWLAAGNKDVDVYQTDVIWAPQLAEQFVDLTEATKDVVGEHFPSII
QSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWDELAATAKEVQDKERAAGSAD
IWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAP
KGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSS
TLGGWNLAVSKYSDEQEAAIAFVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPF
MPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLSGNGTAAENLELLEVELTELKG
DAW