Protein Info for SM_b20281 in Sinorhizobium meliloti 1021

Annotation: spermidine/putrescine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 121.7 bits, see alignment E=3.5e-39 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 35 to 354 (320 residues), 358.6 bits, see alignment E=1.4e-111 PF08402: TOBE_2" amino acids 279 to 354 (76 residues), 49.3 bits, see alignment E=4.5e-17

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to sme:SM_b20281)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WQ8 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SM_b20281 spermidine/putrescine ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MQPVVHFKNVNKYYGGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGE
IYLEGKPITHLPPNRRNVNIVFQDYALFPHLNVGRNIAFGLELKGLSSDAIHKRTMELLA
LVKLQDFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTI
QRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVANFIGQSNF
LEGKLLSHDGTTAAIDWNGSIIHADLNGTKLPAGSGATVALRPEALYCMAEQPKDRFALR
GRIVQRVFKGAHTSLTIELENGAELALQLDPVALSHLERDEVWVGWRERDAVVLAD