Protein Info for SM_b20244 in Sinorhizobium meliloti 1021

Annotation: CDP-tyvelose-2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF02719: Polysacc_synt_2" amino acids 24 to 148 (125 residues), 38.5 bits, see alignment E=2.8e-13 PF01370: Epimerase" amino acids 24 to 285 (262 residues), 179.9 bits, see alignment E=2e-56 PF04321: RmlD_sub_bind" amino acids 24 to 250 (227 residues), 45.1 bits, see alignment E=2.5e-15 PF01073: 3Beta_HSD" amino acids 25 to 223 (199 residues), 56.6 bits, see alignment E=7.3e-19 PF16363: GDP_Man_Dehyd" amino acids 25 to 157 (133 residues), 86.6 bits, see alignment E=8.1e-28 amino acids 172 to 349 (178 residues), 62.8 bits, see alignment E=1.4e-20 PF07993: NAD_binding_4" amino acids 91 to 237 (147 residues), 48.9 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K12454, CDP-paratose 2-epimerase [EC: 5.1.3.10] (inferred from 100% identity to smk:Sinme_3929)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WU5 at UniProt or InterPro

Protein Sequence (373 amino acids)

>SM_b20244 CDP-tyvelose-2-epimerase (Sinorhizobium meliloti 1021)
MSGRTVGTDRHLAAPALSGKAAPILVVGGSGFLGCNLADSFLRDGEHVIVLDNLSRPGVE
RNLEWLVDGHGRAVEALIADIRDLGAIEAAFRDAKAVFHFAAQTAVTTSLERPTDDFETN
ARGTLNVLEAARLAGRRAPVIFASTNKVYGALGHIEMQDMRGRYMPADEATREHGVSETQ
PLDFCTPYGCSKGVADQYVLDYARSFGLPTAVLRMSCVYGPRQFGTEDQGWVAHFLIRAL
AGEPISIYGDGKQVRDILHVTDAVAAYRALLNSIDRLKGRAFNLGGGPGNAVSIVDVLNE
IELLTGRKLATAKSDWRAGDQLYFVADTRAIADALGWKAGMPWREGLRDLYAWLHDDRGA
VSGIRRQPRRVTA