Protein Info for SM_b20215 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 41 to 178 (138 residues), 65.3 bits, see alignment E=9.1e-22 PF00165: HTH_AraC" amino acids 229 to 262 (34 residues), 34.6 bits, see alignment 2.4e-12 PF12833: HTH_18" amino acids 239 to 317 (79 residues), 66.9 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20215)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WW9 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SM_b20215 transcriptional regulator (Sinorhizobium meliloti 1021)
MRRRIPARKSPMHRIGFVVFPRFQLMGFAAVTAFEMANLALGETVYEIELLSEAGGEVKS
SAGFGVLTKTFDHTAYDTVMFGAGVQIEPMTPGLVEFARRSFETARRVAAPCTGAFVLAE
SGLLDGRRATTHWAFARQLQDRFPAVKVEEDRIFIVDGSVWTSAGMTASIDLALAMVEKD
YGQGVARSVARKLVVYHRRAGGQSQFSALLELEPKSDRIQRSIDYAKANLRRGLSVEELA
DAAGLSARQFSRAFRAETGQSPAKAVETLRVEAARLMMEQGRHSMDVIAEETGFAIADRM
RRAFLRTLGQPPQTIRRNARESASVP