Protein Info for SM_b20213 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF08534: Redoxin" amino acids 324 to 436 (113 residues), 45.1 bits, see alignment E=1.4e-15 PF00578: AhpC-TSA" amino acids 324 to 431 (108 residues), 47.9 bits, see alignment E=1.9e-16 PF17991: Thioredoxin_10" amino acids 482 to 627 (146 residues), 161.8 bits, see alignment E=2.4e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20213)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WX1 at UniProt or InterPro

Protein Sequence (627 amino acids)

>SM_b20213 hypothetical protein (Sinorhizobium meliloti 1021)
MRPSAIRYRSPCYETQSGYLALVPCSACQARPPPQEAQVQCRGTKMILFTIAYLAGALTI
LSPCILPVLPFVFSRAGQPFARSVLPMLIGMVLTFAGVATLAALGGDWAVQANVAGRYAA
IAVLAGFGVTLLSTRAAALFTRPAVALGSRLSQKMAGQPPSVGASLLLGVATGLLWAPCA
GPILGLVLTGAALHGANVETTLLLAAYAAGAATSLALAVLAGGRVFAAMKRSLGLGERLR
QGLGIAVLAGVAAIALGLDTGQLARLSYASTAAIEQSLLDGVRGDSVEDRASTAVGGEGP
AYRSDLPVEGMFPPLDGAVEWVNSKPLSVEQLRGKVVLVDFWTYSCINCIRTIPYVRAWA
EKYRDQGLVVIGVHAPEFAFEKRIANVRSAVTDFDIRYPVAIDNDFAIWRAFGNSYWPAH
YFIDAEGRIRHHHFGEGDYARSERVIQELLAEAAGSRRGDSGFVQPDATGAEAAPDLANL
QSGEDYVGYMRASNFVSPERVAADAAHEYTAGEPRLNQWSLAGNWTVGAEQATLNRAGGA
ITYRFSARDLHLVLGPGENGRRVRFQVKVDGAAPGPDHGSDIDSDGYGTVGETRLYQLVR
QSGEVRERTFEIRFLEPGVEAFVFTFG