Protein Info for SM_b20208 in Sinorhizobium meliloti 1021

Annotation: pyrroloquinoline quinone biosynthesis protein PqqE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 17 to 373 (357 residues), 609.9 bits, see alignment E=1.4e-187 PF04055: Radical_SAM" amino acids 28 to 184 (157 residues), 94.1 bits, see alignment E=1.6e-30 PF13353: Fer4_12" amino acids 30 to 111 (82 residues), 22.2 bits, see alignment E=2.4e-08 PF13186: SPASM" amino acids 256 to 318 (63 residues), 37.2 bits, see alignment E=4.3e-13 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 260 to 345 (86 residues), 38.7 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 100% identical to PQQE_RHIME: PqqA peptide cyclase (pqqE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 100% identity to smk:Sinme_3964)

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9EXU8 at UniProt or InterPro

Protein Sequence (375 amino acids)

>SM_b20208 pyrroloquinoline quinone biosynthesis protein PqqE (Sinorhizobium meliloti 1021)
MSDTIARPAETARTLPRILPPMAMLAELTHRCPLACPYCSNPIALTQAKEELSTEEWTGV
FAQAADLGVLHLHLSGGEPAARRDLVELTQAASSLGLYTNLITSGVGLTEARMNSLADAG
LDHIQLSIQGVSPESADRIGGYKGGYERKMAVAGWAADAAIPLTLNAVCHRQNMGEIDEM
IELAIRLKARRIEVATVQFHGWAERNKEVLMPTREQVECATRTVAEAREKYQGILVIDYV
PADYYSKYPKACMGGWGRVGLNVTPSGRVLPCHAAETIPSLSFENVRENSLSSIWYESNA
FNAYRGEDWMPELCRSCERKKVDFGGCRCQAMALAGDASATDPVCIRSPLRDRLTLEVEQ
LSAPSVVPMNYRGRA