Protein Info for SM_b20203 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00126: HTH_1" amino acids 6 to 64 (59 residues), 60.9 bits, see alignment E=9.2e-21 PF03466: LysR_substrate" amino acids 90 to 294 (205 residues), 175.3 bits, see alignment E=1.1e-55

Best Hits

Swiss-Prot: 100% identical to CBBR_RHIME: HTH-type transcriptional regulator CbbR (cbbR) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20203)

Predicted SEED Role

"RuBisCO operon transcriptional regulator CbbR" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58332 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SM_b20203 transcriptional regulator (Sinorhizobium meliloti 1021)
MRNVTFRQLRTVEAVCRLGKINLAAEALGLTGPALTLQIQHLERDAGIALFDRTRGGMVP
TAYGLAFLEAARAIEDSLIALEDSIDAIKGLRTGRLRLGVVSTGKYFAPQLIAAFRDQVP
AVEINLFIGNRAEIIAKLRDHEIDIALMGRPPRDFEVRAQVFGDHPLVFIAPAGHPLAGV
LEISRERIAQEQFLVREKGSGTRISLEIFLSDTPHELEELGTEIASNETIKQAVIAGLGI
AFISAHTIEQEVKLGRLVILDVIDTPIRRQWFTVSRLDRVATPAMQAFERFVLASGARYL
PVVSKPYPANAFG