Protein Info for SM_b20182 in Sinorhizobium meliloti 1021

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 219 to 246 (28 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 244 (162 residues), 70.9 bits, see alignment E=6.1e-24

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to sme:SM_b20182)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WY0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SM_b20182 ABC transporter (Sinorhizobium meliloti 1021)
MDCSCTLNKTLQHPALVRALSLGLLLLLWIAAAGFTDDASVLPQPWALWEPFVQAVSSGA
LPYHLGMTLWRVICAFVPAMVIGVAIGFLMGRVAAVDRWLDPWLVVFLNLPALVLIVLCY
IWIGLNETAAITAVVLNKIPNVATLLREGARALDPDLDSMAAVYRMRPLARLRHVIMPQL
APFIAAAARSGIAVIWKIVLVVEFLGRSSGIGFQIHFYFQLFNVAMVLVYALSFIGVMLL
VEAFFLQPAERRVRRWRTA