Protein Info for SM_b20142 in Sinorhizobium meliloti 1021

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 293 (181 residues), 112 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_4025)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X20 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SM_b20142 oligopeptide ABC transporter permease (Sinorhizobium meliloti 1021)
MTLASTDNVIVAEPSFPVRMMRMLLADKFALCAAIFLLVILTIAIIGPPWLGDLATKQNL
RGRNLPPFDWTRTWVWWMGADALGRPLFARIIVAAQNTLMVAAGAVILSSVIGTVLGLIA
GFSSPRMSQIIMRLADVIMSFPSLLIAVIVLYVLGSSILNLMLVLAITRIPVYLRTTRAE
VLEIRERMFVQAARVMGASSKRILFRHILPVVLPTLTTLATLDFAYVMLAESALSFLGIG
IQPPEITWGLMISQGRQYLTNAWWLSFWPGLAIILTTMSLNLLSNWMRIALDPVQRWRLE
MKGGKNG